NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2212282852

Scaffold 2212282852


Overview

Basic Information
Taxon OID2209111004 Open in IMG/M
Scaffold ID2212282852 Open in IMG/M
Source Dataset NameMacrotermes natalensis queen gut microbiome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3545
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Macrotermes Natalensis Queen Gut → Macrotermes Natalensis Queen Gut Microbial Communities From Naboomspruit, South Africa

Source Dataset Sampling Location
Location NameSouth Africa: Naboomspruit
CoordinatesLat. (o)-24.5160467Long. (o)28.699288Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049726Metagenome146Y

Sequences

Protein IDFamilyRBSSequence
2212342125F049726N/AMYPTPYILSRVYFLNLLTPTGYVMHQQFNIQQLYVLPTLYLCVLYLSENKQRLVPLTA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.