Basic Information | |
---|---|
Taxon OID | 2209111022 Open in IMG/M |
Scaffold ID | 2221206376 Open in IMG/M |
Source Dataset Name | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1067 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rothamsted, Harpenden, UK | |||||||
Coordinates | Lat. (o) | 51.481481 | Long. (o) | 0.222231 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000596 | Metagenome / Metatranscriptome | 999 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2222039539 | F000596 | GGAGG | VKSIAGAGMNARELGIMCALLAAMPNLAGCESARSQDYQFEKQVKRAQECRQLQDKLVGDQPLTPERGEEIAKTMSRNGCTARFHDQ |
⦗Top⦘ |