NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2222456529

Scaffold 2222456529


Overview

Basic Information
Taxon OID2222084004 Open in IMG/M
Scaffold ID2222456529 Open in IMG/M
Source Dataset NameMarine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - oil_4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAlabama State University
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)503
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine → Marine Microbial Communities From Deepwater Horizon Oil Blowout, Alabama, Usa

Source Dataset Sampling Location
Location NameDaulphin Laboratory, Alabama, USA
CoordinatesLat. (o)30.15Long. (o)-88.446Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015864Metagenome / Metatranscriptome251Y
F021974Metagenome / Metatranscriptome216Y

Sequences

Protein IDFamilyRBSSequence
2222542950F015864N/AMTDIRYSTGEELEQFLYEKCKEDSDLLATIISEYVCSLSDSKLTELEDFLTNNFGDD
2222542951F021974N/ANNTNIVSEIYSYHTDWKEGKVNQMWIEQSGDENKGYSYVAVAHNPRNGKTMEMSNPRTSYQETLKWVRGWCGTFCTLPA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.