Scaffold SS13_p0176375

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SS13_p0176375

Scaffold SS13_p0176375

Overview

Basic Information
Taxon OID	2236876017 Open in IMG/M
Scaffold ID	SS13_p0176375 Open in IMG/M
Source Dataset Name	Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS13
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	GATC-Biotech AG, Konstanz, Germany
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	500
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain

Source Dataset Sampling Location
Location Name	Spain: Bras del Port
Coordinates	Lat. (^o)	38.11	Long. (^o)	-0.36	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031511	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
SS13_01763751	F031511	GAGG	VASKIPGGGGEVKLNFKGMGELLRSSELESELRNRMRRVQAAVPGSELYTTTSRRARAVVARGSDFDEANTGELSRALDLAGGQRGFKVKTN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.