NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ARcpr5oldR_c002342

Scaffold ARcpr5oldR_c002342


Overview

Basic Information
Taxon OID3300000041 Open in IMG/M
Scaffold IDARcpr5oldR_c002342 Open in IMG/M
Source Dataset NameArabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1763
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location
Location NameUSA: Bethesda, Maryland
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007651Metagenome / Metatranscriptome347N
F054450Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
ARcpr5oldR_0023421F054450N/AMHKFFYGNNSQSNKHRPTPTLRPVNISKEQLRDFRNQLSDPRTSQKIKKRFMVEKAGGYCSVCGDIATQIASYNMDGA
ARcpr5oldR_0023422F007651N/AMSNDLNELIGRKDKLEGELNHELSADYNELMKKMSESFRDMHEDSVKYYKQKANEQLDKMEKNIQSGNKLSAINEKLLADTYLSLAITI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.