Scaffold DelMOSpr2010_c10140086

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold DelMOSpr2010_c10140086

Scaffold DelMOSpr2010_c10140086

Overview

Basic Information
Taxon OID	3300000116 Open in IMG/M
Scaffold ID	DelMOSpr2010_c10140086 Open in IMG/M
Source Dataset Name	Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	843
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Microbial Communities From Delaware Coast

Source Dataset Sampling Location
Location Name	Microbial Observatory off the coast of Delaware, USA
Coordinates	Lat. (^o)	38.848917	Long. (^o)	-75.1076	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008128	Metagenome / Metatranscriptome	338	Y

Sequences

Protein ID	Family	RBS	Sequence
DelMOSpr2010_101400863	F008128	N/A	MEPVYKTKLTVSFAVDLEVEYNSFDGKTADDIADALQDELQDLLFELEQVTAVYTSCTS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.