NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold KGI_S1_ANT01_95mDRAFT_c10128592

Scaffold KGI_S1_ANT01_95mDRAFT_c10128592


Overview

Basic Information
Taxon OID3300000119 Open in IMG/M
Scaffold IDKGI_S1_ANT01_95mDRAFT_c10128592 Open in IMG/M
Source Dataset NameMarine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)708
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location NameS1 site, Potter Cove, King George Island, Antarctic Peninsula
CoordinatesLat. (o)-62.230512Long. (o)-58.656117Alt. (m)Depth (m)9.5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067128Metagenome126Y

Sequences

Protein IDFamilyRBSSequence
KGI_S1_ANT01_95mDRAFT_101285923F067128N/AMIIFTILGIFTAIFISTVIIMSVIEGRARNKTNEKIVWKMDKVETRTGGLENDRLNERQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.