Basic Information | |
---|---|
Taxon OID | 3300000123 Open in IMG/M |
Scaffold ID | KGI_S2_ANT06_2345mDRAFT_c1010139 Open in IMG/M |
Source Dataset Name | Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S2 sample ANT 06_23.45m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2813 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | S2 site, Potter Cove, King George Island, Antarctic Peninsula | |||||||
Coordinates | Lat. (o) | -62.231932 | Long. (o) | -58.655087 | Alt. (m) | Depth (m) | 23.45 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F084255 | Metagenome / Metatranscriptome | 112 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
KGI_S2_ANT06_2345mDRAFT_10101392 | F084255 | N/A | MESSKRYLLQAEIEYWHEMLYLNKSRMPKNKEVEMRDCLKKAVRAMNTNSIGDFRAAA* |
⦗Top⦘ |