 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300000124 Open in IMG/M |
| Scaffold ID | BS_KBA_SWE12_21mDRAFT_c10093374 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 744 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | KBA site, Vaertahamnen, Baltic Sea, Sweden | |||||||
| Coordinates | Lat. (o) | 59.363333 | Long. (o) | 18.119167 | Alt. (m) | Depth (m) | 21 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013402 | Metagenome / Metatranscriptome | 271 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BS_KBA_SWE12_21mDRAFT_100933741 | F013402 | N/A | MQTQVELNAAQAAIYTRTNLSRAFQDFDDTDIGGIYLRGDDCLVVRRDGSEQAYNRELIKTSFNTYTHRLKDFFSYLGPNYRGPSVWHNNAYILFKGWNYSHALGHLSSHAKLQAHWADKFIHVSNTDKVLHLLQSDQTDIGHLVAPDGLRLSNRPIDIDGDM |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |