Scaffold KGI_S2_ANT05_2345mDRAFT_c1082769

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold KGI_S2_ANT05_2345mDRAFT_c1082769

Scaffold KGI_S2_ANT05_2345mDRAFT_c1082769

Overview

Basic Information
Taxon OID	3300000132 Open in IMG/M
Scaffold ID	KGI_S2_ANT05_2345mDRAFT_c1082769 Open in IMG/M
Source Dataset Name	Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S2 sample ANT 05_23.45m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	501
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location Name	S2 site, Potter Cove, King George Island, Antarctic Peninsula
Coordinates	Lat. (^o)	-62.231932	Long. (^o)	-58.655087	Alt. (m)		Depth (m)	23.45
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097365	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
KGI_S2_ANT05_2345mDRAFT_10827692	F097365	GAGG	MVNKSDWQEMKRHAFDAFARDGRMSVSELENIVNIGVADGEFDEQEKAVLINIISNLTRADMNDAMWLKVDELIHKFDLHDDSEAFIEHLDDDNEY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.