NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPaug08P261000mDRAFT_c1006829

Scaffold LPaug08P261000mDRAFT_c1006829


Overview

Basic Information
Taxon OID3300000157 Open in IMG/M
Scaffold IDLPaug08P261000mDRAFT_c1006829 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 1000m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1903
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameLine P, North Pacific Ocean
CoordinatesLat. (o)48.35Long. (o)-123.3Alt. (m)Depth (m)1000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001334Metagenome / Metatranscriptome720Y
F044553Metagenome / Metatranscriptome154N

Sequences

Protein IDFamilyRBSSequence
LPaug08P261000mDRAFT_10068294F001334N/AMMKFKEYLQLNADDSIEQVMDGEWILKSRSSWKATDDEDNKLEIHNDGHDPELNGESWSVHTNTFAPKAFAFFCKQFIKEAKPSEVTHARSRIYPQSSN*
LPaug08P261000mDRAFT_10068295F044553GAGGMPDQESIHNLQTEIQTLKIKDEFRTKELDALMKKLSDTSSKLNELSENIGRLLAGQDLHKTSDNEVRDELKILHTRIGDLHDKCTEMIDKTETRVSSDISL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.