NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPaug08P2610mDRAFT_c1000019

Scaffold LPaug08P2610mDRAFT_c1000019


Overview

Basic Information
Taxon OID3300000159 Open in IMG/M
Scaffold IDLPaug08P2610mDRAFT_c1000019 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)41865
Total Scaffold Genes55 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (21.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP26, Pacific Ocean
CoordinatesLat. (o)50.0Long. (o)-145.0Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016009Metagenome / Metatranscriptome250Y
F024656Metagenome / Metatranscriptome205Y
F087229Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
LPaug08P2610mDRAFT_100001911F087229AGTAGMNIYDYITDDELVKDPLITKKILDGLTPRQNKMLDEGRLLINPVNGDMVVPVMRQGGIAKIIVNIY*
LPaug08P2610mDRAFT_100001915F024656N/AMSKQTKDWMERLVENYRVPTEEEVKQKTQKKKVLKESQIKRILERD*
LPaug08P2610mDRAFT_10000193F016009N/AMILHSEEYNKEMKRYRIIEHQLRDKSVFVVEWNDRWFFGIWGTWHERFHCFELEEAMNKIQRLIKIKKR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.