Scaffold SI39nov09_120mDRAFT_c1074658

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SI39nov09_120mDRAFT_c1074658

Scaffold SI39nov09_120mDRAFT_c1074658

Overview

Basic Information
Taxon OID	3300000167 Open in IMG/M
Scaffold ID	SI39nov09_120mDRAFT_c1074658 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 120m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	615
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	Saanich Inlet 39, Vancouver Island, BC, Canada
Coordinates	Lat. (^o)	48.35	Long. (^o)	-123.29	Alt. (m)		Depth (m)	120
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103400	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
SI39nov09_120mDRAFT_10746582	F103400	GGAG	LATPTAGSKLSLGKLGRATAVDNANYTSKTSLNSCARDSSTGKASLSDFYISAVNSTLDGYPYVDEQTNEIYEL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.