Scaffold SI34jun09_135mDRAFT_1075089

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SI34jun09_135mDRAFT_1075089

Scaffold SI34jun09_135mDRAFT_1075089

Overview

Basic Information
Taxon OID	3300000226 Open in IMG/M
Scaffold ID	SI34jun09_135mDRAFT_1075089 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 135m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	607
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	Saanich Inlet 34, Vancouver Island, BC, Canada
Coordinates	Lat. (^o)	48.6	Long. (^o)	-123.5	Alt. (m)		Depth (m)	135
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071095	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
SI34jun09_135mDRAFT_10750892	F071095	N/A	MSWLNSLLNRNKSKTIQVELLDETDKSIKIKYGIHTTYLPKKIITFDRVNTDRIVKVRLPMWLYRKKFI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.