NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TB_AS07_7DRAFT_10007374

Scaffold TB_AS07_7DRAFT_10007374


Overview

Basic Information
Taxon OID3300000227 Open in IMG/M
Scaffold IDTB_AS07_7DRAFT_10007374 Open in IMG/M
Source Dataset NameGroundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- AS07_7
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)5985
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (11.11%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy

Source Dataset Sampling Location
Location NameAcquasanta Terme, Italy
CoordinatesLat. (o)42.766667Long. (o)13.4Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093503Metagenome106Y

Sequences

Protein IDFamilyRBSSequence
TB_AS07_7DRAFT_100073747F093503N/AMKKYKVKIKHTDKEEIIKANSELEARVKFCEKNNLNYTHLAGRLEIILNNKPLQNNL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.