Scaffold BS_KBA_SWE21_205mDRAFT_10095257

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BS_KBA_SWE21_205mDRAFT_10095257

Scaffold BS_KBA_SWE21_205mDRAFT_10095257

Overview

Basic Information
Taxon OID	3300000241 Open in IMG/M
Scaffold ID	BS_KBA_SWE21_205mDRAFT_10095257 Open in IMG/M
Source Dataset Name	Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	644
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location Name	KBB site, Vaertahamnen, Baltic Sea, Sweden
Coordinates	Lat. (^o)	59.350163	Long. (^o)	18.107847	Alt. (m)		Depth (m)	20.5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082775	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
BS_KBA_SWE21_205mDRAFT_100952571	F082775	AGGAGG	MSEPDILYPAIFVFSMLLIGLLLTMWEFSRLYKRQQQKVENDKRFMDSRVYRENVRNVSHF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.