Scaffold TDF_OR_ARG05_123mDRAFT_1001005

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TDF_OR_ARG05_123mDRAFT_1001005

Scaffold TDF_OR_ARG05_123mDRAFT_1001005

Overview

Basic Information
Taxon OID	3300000242 Open in IMG/M
Scaffold ID	TDF_OR_ARG05_123mDRAFT_1001005 Open in IMG/M
Source Dataset Name	Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	8461
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (58.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location Name	Ushuaia Bay, Tierra del Fuego, Argentina
Coordinates	Lat. (^o)	-54.810872	Long. (^o)	-68.295525	Alt. (m)		Depth (m)	12.3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076109	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
TDF_OR_ARG05_123mDRAFT_100100512	F076109	GAGG	MGVLFNILFVIAVIATICCLCVFIGGLFIWFQKNELPDIEDF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.