Scaffold LP_A_09_P04_10DRAFT_1000028

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LP_A_09_P04_10DRAFT_1000028

Scaffold LP_A_09_P04_10DRAFT_1000028

Overview

Basic Information
Taxon OID	3300000265 Open in IMG/M
Scaffold ID	LP_A_09_P04_10DRAFT_1000028 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	45668
Total Scaffold Genes	47 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	28 (59.57%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	Line P, Station P4
Coordinates	Lat. (^o)	48.65	Long. (^o)	-126.666667	Alt. (m)		Depth (m)	10
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059019	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
LP_A_09_P04_10DRAFT_100002847	F059019	GGA	MKNNKGYTMKKIIEYMSVIMATVGTLAMVGAVGSIEIDKYLQGASMTLIGVASYILALYAQELYKEDK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.