Basic Information | |
---|---|
Taxon OID | 3300000265 Open in IMG/M |
Scaffold ID | LP_A_09_P04_10DRAFT_1067182 Open in IMG/M |
Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 510 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Line P, Station P4 | |||||||
Coordinates | Lat. (o) | 48.65 | Long. (o) | -126.666667 | Alt. (m) | Depth (m) | 10 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043384 | Metagenome / Metatranscriptome | 156 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LP_A_09_P04_10DRAFT_10671822 | F043384 | AGGAG | MSQGMIIYAIICVILGITFMALGDLILGTLVALCGPLWLAIQVNANDEEDE* |
⦗Top⦘ |