Scaffold M3P_10018670

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold M3P_10018670

Scaffold M3P_10018670

Overview

Basic Information
Taxon OID	3300000268 Open in IMG/M
Scaffold ID	M3P_10018670 Open in IMG/M
Source Dataset Name	Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Minnesota
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2488
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic → Lotic Microbial Communities From Mississippi River At Two Locations In The State Of Minnesota

Source Dataset Sampling Location
Location Name	USA: Solway, Minnesota
Coordinates	Lat. (^o)	47.349634	Long. (^o)	-95.182806	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080911	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
M3P_100186701	F080911	GGA	MPNSHASDYKRNLRKEIAGYFIVVLCALPIRFWLHAAVKEQDSWLGFLAGQAFGYLTVGAVGAIFVSKLNLRTKLILTFLIVAL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.