Basic Information | |
---|---|
Taxon OID | 3300000268 Open in IMG/M |
Scaffold ID | M3P_10147764 Open in IMG/M |
Source Dataset Name | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Minnesota |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 714 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic → Lotic Microbial Communities From Mississippi River At Two Locations In The State Of Minnesota |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Solway, Minnesota | |||||||
Coordinates | Lat. (o) | 47.349634 | Long. (o) | -95.182806 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103235 | Metagenome | 101 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
M3P_101477641 | F103235 | N/A | YWNKSDVILRWYENDKWSFFLDDLDTSASTVFLMGSHFMDTIYDGGTLGQSSTPSHVSNGVMLMSPKKTANIAGDKVLHLTFEVDPHFSGRRWCDILLLPAGEVVYSGKAADKIQQNTKSGKLFRWAINAGGHSMNVDTGYNLDGSRKSYNIPIKYVGRDHMPWNLPAPYRKVNRTTKNTTLYLCFFSFKHLHIPHHYARPTGLFIFSAL* |
⦗Top⦘ |