Scaffold M3P_1053911

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold M3P_1053911

Scaffold M3P_1053911

Overview

Basic Information
Taxon OID	3300000269 Open in IMG/M
Scaffold ID	M3P_1053911 Open in IMG/M
Source Dataset Name	Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 7, Mississippi Headwaters
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Minnesota
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	589
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic → Lotic Microbial Communities From Mississippi River At Two Locations In The State Of Minnesota

Source Dataset Sampling Location
Location Name	In downtown Hastings
Coordinates	Lat. (^o)	44.745767	Long. (^o)	-92.85015	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014107	Metagenome / Metatranscriptome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
M3P_10539111	F014107	GAG	MSLNTILSIAESVTINDHRFVGQTVSRNQKILTSEIITVVPFQFTLRPMNYLLYSQSRSILNALRIPDKALEQYLNFGSTGWLNYIKYQGDMTSAQIAACRWQTSSANKILVLGSLPSISSGSYLFRIGDFVQVDRYTYIVTADVLRGAGATVNVPVHRNLIATLA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.