NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold EM173_1002169

Scaffold EM173_1002169


Overview

Basic Information
Taxon OID3300000274 Open in IMG/M
Scaffold IDEM173_1002169 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from Cork, Ireland - EM173
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI), Macrogen
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3323
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population

Source Dataset Sampling Location
Location NameCork, Ireland
CoordinatesLat. (o)51.907Long. (o)-8.472Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078006Metagenome117N
F080673Metagenome115N

Sequences

Protein IDFamilyRBSSequence
EM173_10021693F080673GGAMKLQDEALLYLRDNITKDEAYYILTTDKEMIEILISDKKDGSKRIKILDMEYTIEKDDMLLLFDTDGIIDECLLVASCIGVNMYFRRQDVNAILNNINREKVMGYPYIAIQLDNIQTIEKRRVIFDITGHRMDDNKERIDFMFVYFMARLCV*
EM173_10021698F078006N/AMIRGQFPAPWHNLNVSSMEDNILKRAAAELKEAGCRVFAWQDDTYNRGWSKGDYIMLYYAFPDSPSIGYLSHGEYGMSVAYSRAYIPSRGSGSGCCVKEEATFDLETALDVLNGPLPRWCRSYGVYPKQYDNIDKWYNSDNHNKKLFKEI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.