NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold bgg_mtDRAFT_1029954

Scaffold bgg_mtDRAFT_1029954


Overview

Basic Information
Taxon OID3300000305 Open in IMG/M
Scaffold IDbgg_mtDRAFT_1029954 Open in IMG/M
Source Dataset NameBlue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)577
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Blue Grama Grass Rhizosphere Eukaryotic And Microbial Communities From Sevilleta Long Term Ecological Research Site, New Mexico, Us

Source Dataset Sampling Location
Location NameSevilleta Long Term Ecological Research site, New Mexico, US
CoordinatesLat. (o)34.3348Long. (o)-106.631Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066357Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
bgg_mtDRAFT_10299541F066357AGGAGGLKKWMMLAAILALVLVAAAPVVAQVAFEIGDTENESGGIGTSNEFEIEGNNNSACLGQQQFGQTGNFTNQQGALQYASGVDDLEFGGGELSFAPESETACEQAVQQSSAASSFAP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.