Basic Information | |
---|---|
Taxon OID | 3300000305 Open in IMG/M |
Scaffold ID | bgg_mtDRAFT_1030998 Open in IMG/M |
Source Dataset Name | Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2409 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Blue Grama Grass Rhizosphere Eukaryotic And Microbial Communities From Sevilleta Long Term Ecological Research Site, New Mexico, Us |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sevilleta Long Term Ecological Research site, New Mexico, US | |||||||
Coordinates | Lat. (o) | 34.3348 | Long. (o) | -106.631 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F037234 | Metagenome / Metatranscriptome | 168 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
bgg_mtDRAFT_10309981 | F037234 | N/A | DIPDKPIILMIKYLILDPKPSDLTMIRVIKARTGYRCKDTEELW* |
⦗Top⦘ |