 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300000340 Open in IMG/M |
| Scaffold ID | EchG_transB_7880CDRAFT_1018810 Open in IMG/M |
| Source Dataset Name | Ferrous microbial mat and aquatic microbial communities from Echinus Geyser, Yellowstone National Park, USA - transect B T=78-80 C |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 557 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat And Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Echinus Geyser, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.7220558 | Long. (o) | -110.7021057 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020733 | Metagenome / Metatranscriptome | 222 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| EchG_transB_7880CDRAFT_10188102 | F020733 | AGG | MSEIVWDDEKKEYVRAREIEERKLIQKIIQELINALQNNYTLQIQINLQNGT* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |