Scaffold EchG_transB_7880CDRAFT_1019446

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold EchG_transB_7880CDRAFT_1019446

Scaffold EchG_transB_7880CDRAFT_1019446

Overview

Basic Information
Taxon OID	3300000340 Open in IMG/M
Scaffold ID	EchG_transB_7880CDRAFT_1019446 Open in IMG/M
Source Dataset Name	Ferrous microbial mat and aquatic microbial communities from Echinus Geyser, Yellowstone National Park, USA - transect B T=78-80 C
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	538
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Microbial Mat And Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	Echinus Geyser, Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.7220558	Long. (^o)	-110.7021057	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087443	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
EchG_transB_7880CDRAFT_10194462	F087443	N/A	VLALQSLKTFLNIKYNMSQRKNYWMXFSDXDNXDYIDXEITKIGVDLDLDPSEIRAWIFKAFVYDLEVRAKVM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.