NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold OneHSP_7476CDRAFT_1006356

Scaffold OneHSP_7476CDRAFT_1006356


Overview

Basic Information
Taxon OID3300000342 Open in IMG/M
Scaffold IDOneHSP_7476CDRAFT_1006356 Open in IMG/M
Source Dataset NameFerrous microbial mat communities from One Hundred Spring Plain, Yellowstone National Park, USA - T=74-76
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1596
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Ferrous Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameOne Hundred Spring Plain, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7330426Long. (o)-110.7089928Alt. (m)Depth (m)2286
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018029Metagenome / Metatranscriptome237Y

Sequences

Protein IDFamilyRBSSequence
OneHSP_7476CDRAFT_10063562F018029AGGMKYLWQIVRKLEEKDELDEEEMRDLIDYLNVLKEGLQKLRILLYMDYVGYIGDFHVVFKDPWYLSEVHVKCLEIDGECGFLYLDDFLWRIFTDQIEVKPFIRNEVAQS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.