NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ICChiseqgaiiFebDRAFT_13604739

Scaffold ICChiseqgaiiFebDRAFT_13604739


Overview

Basic Information
Taxon OID3300000363 Open in IMG/M
Scaffold IDICChiseqgaiiFebDRAFT_13604739 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa, Continuous Corn soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)595
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m).1016
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081522Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
ICChiseqgaiiFebDRAFT_136047391F081522N/AMTPLLRMAALVVAALTVSASAFAQSSLPLPSTDEVVPAGGSETLGTLPMGNLPLPVECPACITVDFNDLTPEQGVSPDRYRTLGLRIEIGPSSTTSGVVEGSLTDVPCDGTRSLKTKPFIGPSFVLRFPDFPHGVTRVSLDAGDLGASDSDSITVKAFSDDALTTLVAFDIGVMLQGAPTGCVRLSVQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.