 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300000422 Open in IMG/M |
| Scaffold ID | BB_Man_A_Liq_inBBDRAFT_1006141 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial community from La Parguera, Puerto Rico - BB Mangrove A Sediment |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1486 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Bioluminescent Bay → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bioluminescent Bay, La Paraguera, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 17.966667 | Long. (o) | -67.0 | Alt. (m) | Depth (m) | .39 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058165 | Metagenome / Metatranscriptome | 135 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BB_Man_A_Liq_inBBDRAFT_10061412 | F058165 | GGA | VSTIAVLIDPARMAEADAVLMMMYGSLSALVDAYFGFSRVVAIK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |