Scaffold LCrCPGB2_illDRAFT_1007326

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LCrCPGB2_illDRAFT_1007326

Scaffold LCrCPGB2_illDRAFT_1007326

Overview

Basic Information
Taxon OID	3300000436 Open in IMG/M
Scaffold ID	LCrCPGB2_illDRAFT_1007326 Open in IMG/M
Source Dataset Name	Soil microbial communities from Colorado Plateau, Greene Butte sample - Light Crust, Colorado Plateau, Green Butte
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2160
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location
Location Name	Moab, Utah
Coordinates	Lat. (^o)	38.714972	Long. (^o)	-109.692944	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033697	Metagenome / Metatranscriptome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
LCrCPGB2_illDRAFT_10073262	F033697	GAGG	VVQQRAGVEGPWLYDRRVRWLLELSIDEDEHFRFGIEGMDGQCIIALDERLLVIKPGFVRGGVFGAAAASIRDGDGTDFGGKVASIRYADIDSIETNPASSNSVIKINALDYQLNESHNDIYQGNDVAPAKDFTLSASLTTIPITRWALAKSKPYLYMISDFIGEAKEE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.