Scaffold PR_CR_10_Liq_3_inCRDRAFT_1002787

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold PR_CR_10_Liq_3_inCRDRAFT_1002787

Scaffold PR_CR_10_Liq_3_inCRDRAFT_1002787

Overview

Basic Information
Taxon OID	3300000517 Open in IMG/M
Scaffold ID	PR_CR_10_Liq_3_inCRDRAFT_1002787 Open in IMG/M
Source Dataset Name	Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	4467
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (85.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location Name	Cabo Rojo, Puerto Rico
Coordinates	Lat. (^o)	17.950617	Long. (^o)	-67.193417	Alt. (m)		Depth (m)	.05
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054790	Metagenome / Metatranscriptome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
PR_CR_10_Liq_3_inCRDRAFT_100278714	F054790	AGG	MTLNEAWASVYAALPDNAFDYVGKPFYNDDDGSIQLWDG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.