 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300000532 Open in IMG/M |
| Scaffold ID | CNAas_1001265 Open in IMG/M |
| Source Dataset Name | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI), Lifesequencing S.L. |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2231 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere → Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sierra Nevada National Park, Granada, Spain | |||||||
| Coordinates | Lat. (o) | 36.96213 | Long. (o) | -3.41928 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041800 | Metagenome | 159 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| CNAas_10012654 | F041800 | AGGA | MRFLLGVLVGYTVRDKQKLLIKVLVTLLVVYVVLWAVVLPAITLLA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |