Scaffold Draft_10012648

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Draft_10012648

Scaffold Draft_10012648

Overview

Basic Information
Taxon OID	3300000558 Open in IMG/M
Scaffold ID	Draft_10012648 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10780
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	18 (78.26%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location Name	Syncrude, Ft. McMurray, Alberta
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.55	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011148	Metagenome / Metatranscriptome	294	Y

Sequences

Protein ID	Family	RBS	Sequence
Draft_100126483	F011148	AGG	MAVFSKNTLTQVSGFDNPIIAGELVYEQQTYWNLSLTSEDGVTPVNLTGATIDASIVRRTLTNVQDTRYGLSFDIGNYTPTPTAIPLTITNRVDATGSFTLVIDDSSWGLVDTDAQLAINSVDGAGFSGRIKISFPAVSGTPAEDNIIFLLFLVRSDGIVKV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.