Basic Information | |
---|---|
Taxon OID | 3300000568 Open in IMG/M |
Scaffold ID | Draft_10550490 Open in IMG/M |
Source Dataset Name | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 615 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032706 | Metagenome / Metatranscriptome | 179 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Draft_105504901 | F032706 | N/A | MRYKFAVPGTVYALEKGDQNKSRGGDIMKAPHKPVAIFQGIDDPTQAFFGQARARVAEDMVSEPIPGRISVPAGGVAERVRKAAGRFVLYEKRGNLGVITAKVQNVGEVYDEIDALLDKIELDEDIQRIAIYTLDGLFASLPI |
⦗Top⦘ |