Scaffold SL_4KL_010_BRINEDRAFT_10004142

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SL_4KL_010_BRINEDRAFT_10004142

Scaffold SL_4KL_010_BRINEDRAFT_10004142

Overview

Basic Information
Taxon OID	3300000575 Open in IMG/M
Scaffold ID	SL_4KL_010_BRINEDRAFT_10004142 Open in IMG/M
Source Dataset Name	Alkaline brine water microbial communities from Picturesque Lake, Kulunda Steppe, Russia - 4KL_010_BRINE
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	8414
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (73.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Brine Water → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location
Location Name	Russia: Kulunda Steppe, Picturesque Lake
Coordinates	Lat. (^o)	51.43	Long. (^o)	79.52	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026202	Metagenome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
SL_4KL_010_BRINEDRAFT_1000414215	F026202	GAG	MKNMVSCNAASKATMLSMGSLEVLLRTSVITVLNLNEMGVTTLPREVLGASLSRPVSCGW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.