Scaffold AF_2010_repII_A1DRAFT_10053349

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold AF_2010_repII_A1DRAFT_10053349

Scaffold AF_2010_repII_A1DRAFT_10053349

Overview

Basic Information
Taxon OID	3300000597 Open in IMG/M
Scaffold ID	AF_2010_repII_A1DRAFT_10053349 Open in IMG/M
Source Dataset Name	Forest soil microbial communities from Amazon forest - 2010 replicate II A1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	1046
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil

Source Dataset Sampling Location
Location Name	Amazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil
Coordinates	Lat. (^o)	-10.171667	Long. (^o)	-62.7875	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024611	Metagenome	205	Y

Sequences

Protein ID	Family	RBS	Sequence
AF_2010_repII_A1DRAFT_100533492	F024611	N/A	MMAIADDRHFSYDNEIELLQFIASEMQKEGLDEDNLDSYLNTKFM*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.