Scaffold ARCol0yngRDRAFT_1005782

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ARCol0yngRDRAFT_1005782

Scaffold ARCol0yngRDRAFT_1005782

Overview

Basic Information
Taxon OID	3300000652 Open in IMG/M
Scaffold ID	ARCol0yngRDRAFT_1005782 Open in IMG/M
Source Dataset Name	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	888
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location
Location Name	University of North Carolina, USA
Coordinates	Lat. (^o)	35.9	Long. (^o)	-79.05	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043319	Metagenome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
ARCol0yngRDRAFT_10057821	F043319	N/A	TITHQKTFSMSKIHDLIVSAVLPIIKGAGKLEMQNVLLGIKEHNTPEIYRTTLQGLHSNFSLLKEAANKTRSNFDDGIVDMVLEAVKESAESDGLVLT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.