Scaffold JGI12272J11983_1150313

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12272J11983_1150313

Scaffold JGI12272J11983_1150313

Overview

Basic Information
Taxon OID	3300000750 Open in IMG/M
Scaffold ID	JGI12272J11983_1150313 Open in IMG/M
Source Dataset Name	Soil microbial communities from Moab, Utah, sample - Soil Crust Dry out, 3 days (biological replicate A) D5A (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	764
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location
Location Name	Moab, Utah
Coordinates	Lat. (^o)	38.714694	Long. (^o)	-109.692944	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000818	Metagenome / Metatranscriptome	878	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12272J11983_11503133	F000818	GGAG	METRNEAKQSKFRIEKLEERIAPAIVAVQENGGGNTPRGNANGVPIENQNPAGKAPPGQN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.