NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12421J11937_10016840

Scaffold JGI12421J11937_10016840


Overview

Basic Information
Taxon OID3300000756 Open in IMG/M
Scaffold IDJGI12421J11937_10016840 Open in IMG/M
Source Dataset NameFreshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2737
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (44.44%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)41.77Long. (o)-81.73Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000957Metagenome / Metatranscriptome821Y
F001923Metagenome / Metatranscriptome617Y
F003583Metagenome / Metatranscriptome478Y
F005588Metagenome / Metatranscriptome395Y

Sequences

Protein IDFamilyRBSSequence
JGI12421J11937_100168401F001923N/AASILGGLAMTARLLLSTEPVSVGWVVRRVLAAAITAALVGYGIQDHIESPGLKMAVVGAAGYAAPECLDYLMRYIKARGDKEVAAVSGKPKKPHAKSKAKGKRGK*
JGI12421J11937_100168402F003583AGAAGMRKAKPRESGASNLLLAVCLLTAFAGLSALASAYISGYVLDTLQSRDALVMIVTDAGIKSDSVSVEQGLSAATLALKAVRDLGWALAVGCLGVGVAVFLRSRRQKA*
JGI12421J11937_100168406F005588N/AMPDPLAHSPDMITIRPNKMPRLWWLFPWSYARVLHMSANALKAYADRLEDMLDLQSRTIKRQAADNAALRQRVADQNDAIIRGSAITPDAYPHE*
JGI12421J11937_100168407F000957N/AMSSFQHLDGMRALLSEVYEVNERIMTGDICSAKSAIASTNMKKMLSHYHEALHEDGATKVSLQAYIAAGGWVGVTYSYELDGFEVSGSQVPRRV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.