NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold AP72_2010_repI_A100DRAFT_1000241

Scaffold AP72_2010_repI_A100DRAFT_1000241


Overview

Basic Information
Taxon OID3300000837 Open in IMG/M
Scaffold IDAP72_2010_repI_A100DRAFT_1000241 Open in IMG/M
Source Dataset NameForest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)10007
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil

Source Dataset Sampling Location
Location NameAmazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil
CoordinatesLat. (o)-10.171667Long. (o)-62.7875Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005007Metagenome / Metatranscriptome415Y
F025347Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
AP72_2010_repI_A100DRAFT_10002413F025347AGGMHTLLLCADVPFLGITRSILNQLQVTPKVVGDSDDALALIENQSFDVIVVDWREIDSVADFLCAVRGSKANQDSVLVAIVRDLLDLRQAFAAAVHFLIHKPASAVQIERCLRAAYCAMVARRRKHHREPVVILASVSTRTQPFGEATMVNLSEGGAKLRTSQQDFVTGVSLSARRRRQFPICPSRRGSHA*
AP72_2010_repI_A100DRAFT_10002414F005007GAGGLLVAAAIVAATAIWLPAYRWFLLISIGIGAGVATVLYLWHKLRPVKEDDVENKRPLGLS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.