Scaffold BpTDRAFT_109887

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BpTDRAFT_109887

Scaffold BpTDRAFT_109887

Overview

Basic Information
Taxon OID	3300000860 Open in IMG/M
Scaffold ID	BpTDRAFT_109887 Open in IMG/M
Source Dataset Name	Marine microbial communities from the coastal margin of the Columbia River, USA - metatranscriptome 33 PSU, 16m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	676
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location Name	Columbia River plume, coastal ocean
Coordinates	Lat. (^o)	46.233	Long. (^o)	-124.16	Alt. (m)		Depth (m)	16
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065210	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
BpTDRAFT_1098872	F065210	N/A	VIFMEITKSQFKSYDGIHELVITHSPHIRSIDIAQHIIDTQNEVVMLKNIIEDLRQREKKKEAIIDNTR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.