Scaffold OpTDRAFT_10012058

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold OpTDRAFT_10012058

Scaffold OpTDRAFT_10012058

Overview

Basic Information
Taxon OID	3300000928 Open in IMG/M
Scaffold ID	OpTDRAFT_10012058 Open in IMG/M
Source Dataset Name	Marine plume microbial communities from the Columbia River - 25 PSU
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13187
Total Scaffold Genes	25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	22 (88.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location Name	Columbia River plume, coastal ocean
Coordinates	Lat. (^o)	46.233	Long. (^o)	-124.16	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017488	Metagenome / Metatranscriptome	240	Y

Sequences

Protein ID	Family	RBS	Sequence
OpTDRAFT_100120589	F017488	AGGAG	MSFVTDGAGKVISFAEYTDVVQKDQRLLEANELRIPAESGFADVTEFVEDMLEKSTNRILLKIKASTWWQAYNNHVGNHISSLSSLPNVNPSLIDPSDALGRRQQFTDMCVYYTFKEYLIPLVAQFENEGADVVKIEYYNGKFNDLFNELLSMADWYDYDNSGTVESDEKVYSYTQTRRTRRPSRIVKVR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.