Scaffold OpTDRAFT_10044336

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold OpTDRAFT_10044336

Scaffold OpTDRAFT_10044336

Overview

Basic Information
Taxon OID	3300000928 Open in IMG/M
Scaffold ID	OpTDRAFT_10044336 Open in IMG/M
Source Dataset Name	Marine plume microbial communities from the Columbia River - 25 PSU
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	638
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location Name	Columbia River plume, coastal ocean
Coordinates	Lat. (^o)	46.233	Long. (^o)	-124.16	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100996	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
OpTDRAFT_100443361	F100996	AGGAG	MKDLNEYQKLDWISFAIQEALNGNMGELEQALALVEDLREPXXXXXVW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.