Scaffold NpDRAFT_10217796

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold NpDRAFT_10217796

Scaffold NpDRAFT_10217796

Overview

Basic Information
Taxon OID	3300000929 Open in IMG/M
Scaffold ID	NpDRAFT_10217796 Open in IMG/M
Source Dataset Name	Marine plume microbial communities from the Columbia River - 15 PSU
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	799
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location Name	Columbia River plume, coastal ocean
Coordinates	Lat. (^o)	46.239	Long. (^o)	-124.161	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009597	Metagenome / Metatranscriptome	315	Y

Sequences

Protein ID	Family	RBS	Sequence
NpDRAFT_102177962	F009597	N/A	MTYAVMVCLDGKDDWIYITKQTEHCWDLQPELFEDAHEAMEFAKTFQLPDKPENVMVVDFYED*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.