Scaffold JGI11838J13071_103790

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI11838J13071_103790

Scaffold JGI11838J13071_103790

Overview

Basic Information
Taxon OID	3300000946 Open in IMG/M
Scaffold ID	JGI11838J13071_103790 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Deep Atlantic Ocean - MP0555
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1031
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	South Atlantic Ocean
Coordinates	Lat. (^o)	-26.91	Long. (^o)	-21.43	Alt. (m)		Depth (m)	3199.21
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032684	Metagenome / Metatranscriptome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11838J13071_1037903	F032684	N/A	MILLCTLRVLALIDKFKSNFSVFKVMFLPFGIITKNTLKNIIQPKITPTDKNANLDPKNFVKQNEITAPIMSSTTIKIILLFINLDLQIRS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.