NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BBAY92_10004864

Scaffold BBAY92_10004864


Overview

Basic Information
Taxon OID3300000947 Open in IMG/M
Scaffold IDBBAY92_10004864 Open in IMG/M
Source Dataset NameMacroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3485
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (14.29%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location
Location NameBotany Bay, Sydney, NSW, Australia
CoordinatesLat. (o)-33.966629Long. (o)151.166614Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005218Metagenome / Metatranscriptome408Y
F011860Metagenome / Metatranscriptome286Y
F015999Metagenome / Metatranscriptome250Y

Sequences

Protein IDFamilyRBSSequence
BBAY92_100048642F011860N/AMAYKKQLQIALDRLDQGLARVHSMVKRGKNAEAMHFMENDLKELYSELQNIITITPETDQSRVGFLE*
BBAY92_100048643F015999N/AMSLNSFFDTLDDDVKFDAWKNSIRQKLIHLKNLIPVENRTQLNYVGETLSFLDSLNLLSSGFLAHHPNMDNKKTLIKRLKTCNSFYKKLGK*
BBAY92_100048646F005218N/AMANDKFYGYNRKPNKVKGNVAGMDPEFESVNPYEFKKLGTTLRESDEDQREKATETVLKNLKDVPAYYSYMEHYETVTRNMDRKPSFKTFLKELEGHSMKEVTEKFTEDKMKEIKLKESIRAEVRNKINELFKTK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.