Scaffold BBAY92_10004895

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BBAY92_10004895

Scaffold BBAY92_10004895

Overview

Basic Information
Taxon OID	3300000947 Open in IMG/M
Scaffold ID	BBAY92_10004895 Open in IMG/M
Source Dataset Name	Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3477
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location
Location Name	Botany Bay, Sydney, NSW, Australia
Coordinates	Lat. (^o)	-33.966629	Long. (^o)	151.166614	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103157	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
BBAY92_100048956	F103157	AGGAG	MTGEQIAGVVRALVAAVGGYFVGKGLVDAETVTTIGGAVATLATAAWSIYAKRA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.