Scaffold JGI11615J12901_12133307

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI11615J12901_12133307

Scaffold JGI11615J12901_12133307

Overview

Basic Information
Taxon OID	3300000953 Open in IMG/M
Scaffold ID	JGI11615J12901_12133307 Open in IMG/M
Source Dataset Name	Soil microbial communities from Great Prairies - Kansas Corn soil
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	503
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location Name	Kansas, USA
Coordinates	Lat. (^o)	39.211666	Long. (^o)	-96.594768	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046571	Metagenome / Metatranscriptome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11615J12901_121333071	F046571	N/A	ATNLFVLHEESKMTLYRWDSMERKFTSTSVKNTTPPPGERVRRIRVGKGQRVRAEVATGELCIRVIEGAWRMQIADSQLTVRHDEAVIIPSGFSHSAEAIEDSFAVQTEDEQEHHVHDSRWAV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.