NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12020J13220_1000670

Scaffold JGI12020J13220_1000670


Overview

Basic Information
Taxon OID3300001058 Open in IMG/M
Scaffold IDJGI12020J13220_1000670 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Indian Ocean - MP0901
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4846
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameEast of Durban, South Africa, South Indian Ocean
CoordinatesLat. (o)-33.55Long. (o)39.89Alt. (m)Depth (m)4002.12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008912Metagenome / Metatranscriptome326Y

Sequences

Protein IDFamilyRBSSequence
JGI12020J13220_10006701F008912N/AMKNLVVTLGITGCGKSRWLKDKSPVIETDDLRIELLDDISDSTTQEGLIFGTAAKKISKLFDTHDTVYFGATLVDSKYRIPFLQSIQDVCKHKLVIDVVIFPGIPELSKERIARDLKSGVQRADSIKFIDEQYEQYLHTMSIFNKEKNFYRSIKRSAE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.